PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10021980m
Common NameCICLE_v10021980mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family DBB
Protein Properties Length: 239aa    MW: 26292.7 Da    PI: 4.535
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10021980mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.42.5e-07444539
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                      C+ +e+ +++  C  ++  lC++C +e H        H++
  Ciclev10021980m  4 QCDVCEKAPATVICCADEAALCAKCDVEVHAAnklaskHQR 44
                     7*****************************65667777765 PP

2zf-B_box27.56.3e-095386235
         zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35
                     + + C+ ++ek + +fC +++ l+C+dC + +H+
  Ciclev10021980m 53 KLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHS 86
                     6789****************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.3147IPR000315B-box-type zinc finger
CDDcd000214.86E-7347No hitNo description
SMARTSM003368.9E-10447IPR000315B-box-type zinc finger
PfamPF006432.0E-5444IPR000315B-box-type zinc finger
SMARTSM003363.0E-145299IPR000315B-box-type zinc finger
PROSITE profilePS501198.9585299IPR000315B-box-type zinc finger
PfamPF006431.8E-75395IPR000315B-box-type zinc finger
CDDcd000212.68E-75598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010100Biological Processnegative regulation of photomorphogenesis
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MKIQCDVCEK APATVICCAD EAALCAKCDV EVHAANKLAS KHQRLLLQCL SNKLPPCDIC  60
QEKAAFIFCV EDRALFCKDC DEPIHSPGSL SANHQRFLAT GIRVALSSSC SKDAERNISE  120
PPNQQASQTS VKMPTQQSSS ISSPWAVDDF LQFSDFESSG KKEQLEFGEL EWIADMGIFN  180
DQLPQEALAA AEVPQLPVSQ PNNLISSYRP TKFNMPYKKP RIEIPDDDDE HFTVPDLG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.212960.0abscission zone| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006442999.11e-176hypothetical protein CICLE_v10021980mg
RefseqXP_006478724.11e-176PREDICTED: B-box zinc finger protein 25-like
SwissprotQ9SID11e-106BBX25_ARATH; B-box zinc finger protein 25
TrEMBLV4VSY51e-176V4VSY5_9R
STRINGPOPTR_0017s05700.11e-142(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27112767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31380.11e-107salt tolerance homologue